Polyclonal Rabbit anti-Human PGC / Pepsin C Antibody (IHC, WB) LS-C332246

Product Overview

• Article Name: Polyclonal Rabbit anti-Human PGC / Pepsin C Antibody (IHC, WB) LS-C332246
• Biozol Catalog Number: LS-C332246-20
• Supplier Catalog Number: LS-C332246-20
• Alternative Catalog Number: LS-C332246-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PGC (NP_001159896.1). PSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMV
• Conjugation: Unconjugated
• Alternative Names: PGC, Gastricsin, Pepsinogen II, Pepsin C, Progastricsin, Pepsinogen group II, PGII, Preprogastricsin, Urinary pepsinogen 1, Pepsinogen C, Progastricsin (pepsinogen C)

Product Description

Pepsin C antibody LS-C332246 is an unconjugated rabbit polyclonal antibody to Pepsin C (PGC) from human. It is reactive with mouse and rat. Validated for IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 5225
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 34kDa/42kDa, while the observed MW by Western blot was 45-50kDa.

Images

Western blot analysis of extracts of various cell lines, using PGC antibody.