Polyclonal Rabbit anti-Human UTS2R / GPR14 Antibody (WB) LS-C332300

Product Overview

• Article Name: Polyclonal Rabbit anti-Human UTS2R / GPR14 Antibody (WB) LS-C332300
• Biozol Catalog Number: LS-C332300-100
• Supplier Catalog Number: LS-C332300-100
• Alternative Catalog Number: LS-C332300-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-389 of human UTS2R (NP_061822.1). LAQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA
• Conjugation: Unconjugated
• Alternative Names: UTS2R, G protein-coupled receptor 14, GPR14, G-protein coupled receptor 14, UII-receptor, Urotensin 2 receptor, UT-II, UTR, UTR2, Uii-r, UR-2-R, Senr, Uii-r1a, Uiir, UR-II-R, Urotensin II receptor, Urotensin-2 receptor

Product Description

GPR14 antibody LS-C332300 is an unconjugated rabbit polyclonal antibody to GPR14 (UTS2R) from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 2837
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 42kDa, while the observed MW by Western blot was 42kDa.

Images

Western blot analysis of extracts of Mouse fetal muscle tissue lysate.