SNRPE Antibody LS-C334087, Unconjugated, Polyclonal

Product Overview

• Article Name: SNRPE Antibody LS-C334087, Unconjugated, Polyclonal
• Biozol Catalog Number: LS-C334087-100
• Supplier Catalog Number: LS-C334087-100
• Alternative Catalog Number: LS-C334087-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC, WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SNRPE (NP_003085.1). MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
• Conjugation: Unconjugated
• Alternative Names: SNRPE, B-raf, Sm protein E, SME, SnRNP-E, Sm-E

Product Description

SNRPE antibody LS-C334087 is an unconjugated rabbit polyclonal antibody to SNRPE from human. It is reactive with human and mouse. Validated for IF, IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 6635
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 10kDa, while the observed MW by Western blot was 11kDa.

Images

Western blot analysis of extracts of various cell lines.

Immunohistochemistry of paraffin-embedded human kidney tissue.

Immunofluorescence analysis of U20S cells.