Polyclonal Rabbit anti-Human PRDM5 Antibody (IHC, IF, WB) LS-C349088

Catalog Number: LS-C349088-100
Article Name: Polyclonal Rabbit anti-Human PRDM5 Antibody (IHC, IF, WB) LS-C349088
Biozol Catalog Number: LS-C349088-100
Supplier Catalog Number: LS-C349088-100
Alternative Catalog Number: LS-C349088-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2). MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQ
Conjugation: Unconjugated
Alternative Names: PRDM5, BCS2, PFM2, PR domain containing 5, PR domain-containing protein 5
PRDM5 antibody LS-C349088 is an unconjugated rabbit polyclonal antibody to PRDM5 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 11107
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 12kDa/58kDa/69kDa/73kDa, while the observed MW by Western blot was 110kDa.
Western blot of extracts of various cell lines, using PRDM5 antibody.
Immunohistochemistry of paraffin-embedded rat spleen tissue.
Immunofluorescence analysis of A549 cells.