PEA3 / ETV4 Antibody (aa1-41) LS-C407911, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C407911-10
Article Name: PEA3 / ETV4 Antibody (aa1-41) LS-C407911, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C407911-10
Supplier Catalog Number: LS-C407911-10
Alternative Catalog Number: LS-C407911-10
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human Pea3 (1-41 aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.
Conjugation: Unconjugated
Alternative Names: ETV4, ETS translocation variant 4, E1A-F, E1AF, Ets variant 4, PEA3, Protein PEA3, PEAS3
Clonality: Polyclonal
NCBI: 2118
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Application Notes: WB (0.1 - 0.5 µg/ml)