Polyclonal Rabbit anti-Human TXN / Thioredoxin / TRX Antibody (IHC, WB) LS-C409195

Catalog Number: LS-C409195-20
Article Name: Polyclonal Rabbit anti-Human TXN / Thioredoxin / TRX Antibody (IHC, WB) LS-C409195
Biozol Catalog Number: LS-C409195-20
Supplier Catalog Number: LS-C409195-20
Alternative Catalog Number: LS-C409195-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-Terminus of human TXN (NP_003320.2). DKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Conjugation: Unconjugated
Alternative Names: TXN, ADF, ATL-derived factor, SASP, Thioredoxin, TRX1, Thioredoxin delta 3, TRX, TXN delta 3, TRDX
TRX antibody LS-C409195 is an unconjugated rabbit polyclonal antibody to TRX (TXN / Thioredoxin) from human. It is reactive with human and mouse. Validated for IHC, IP and WB.
Clonality: Polyclonal
NCBI: 7295
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 9kDa/11kDa, while the observed MW by Western blot was Refer to Figures.
Western blot analysis of extracts of various cells.
Immunohistochemistry of paraffin-embedded mouse lung tissue.
Immunoprecipitation analysis of 150ug extracts of MCF7 cells.