Polyclonal Rabbit anti-Human DNAJB2 Antibody (WB) LS-C497053

Product Overview

• Article Name: Polyclonal Rabbit anti-Human DNAJB2 Antibody (WB) LS-C497053
• Biozol Catalog Number: LS-C497053-100
• Supplier Catalog Number: LS-C497053-100
• Alternative Catalog Number: LS-C497053-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 215-324 of human DNAJB2 (NP_006727.2). GLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
• Conjugation: Unconjugated
• Alternative Names: DNAJB2, DSMA5, DnaJ protein homolog 1, HSPF3, Heat shock 40 kDa protein 3, Heat shock protein J1, Dnaj protein homolog hsj1, HSJ-1, HSJ1

Product Description

DNAJB2 antibody LS-C497053 is an unconjugated rabbit polyclonal antibody to DNAJB2 from human. It is reactive with human and mouse. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 3300
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:200 - 1:2000)
• Application Notes: The predicted MW is 30kDa/35kDa, while the observed MW by Western blot was 42kDa.