TNFRSF10A / DR4 Antibody LS-C661881, Unconjugated, Rabbit, Polyclonal
Catalog Number:
LS-C661881-10
| Article Name: |
TNFRSF10A / DR4 Antibody LS-C661881, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
LS-C661881-10 |
| Supplier Catalog Number: |
LS-C661881-10 |
| Alternative Catalog Number: |
LS-C661881-10 |
| Manufacturer: |
LifeSpan Biosciences |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence at the N-Terminus of human DR4 (99-131 aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
TNFRSF10A, APO2, CD261, DR4, TRAIL-R1, TRAILR-1, TRAILR1, TRAIL receptor 1, CD261 antigen, Cytotoxic TRAIL receptor, Death receptor 4 |
| Clonality: |
Polyclonal |
| NCBI: |
8797 |
| Purity: |
Immunogen affinity purified |
| Form: |
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose |
| Application Notes: |
Flo, ICC, IHC, WB |
![]()
|
Western blot - Anti-DR4 Picoband Antibody |
