EPCAM Antibody LS-C661885, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C661885-10
Article Name: EPCAM Antibody LS-C661885, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C661885-10
Supplier Catalog Number: LS-C661885-10
Alternative Catalog Number: LS-C661885-10
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189 aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen a
Conjugation: Unconjugated
Alternative Names: EPCAM, 323/A3, ACSTD1, 17-1A, CD326, EGP, EGP34, Epithelial glycoprotein, GA733-2, HNPCC8, Ep-CAM, ESA, HEGP314, KS 1/4 antigen, KS1/4, KSA, M1S2, MIC18, MK-1, MH99, TROP1, TACST-1, TACSTD1, CD326 antigen, CO-17A, DIAR5, EGP-2, EGP314, EGP40, Epithelial
Clonality: Polyclonal
NCBI: 4072
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Application Notes: ELISA, Flo, ICC, IHC, IHC-P, WB
Western blot analysis of EPCAM expression in HELA whole cell lysates, A549 whole cell lysates and P