GAA / Alpha-Glucosidase, Acid Antibody LS-C661892, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C661892-10
Article Name: GAA / Alpha-Glucosidase, Acid Antibody LS-C661892, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C661892-10
Supplier Catalog Number: LS-C661892-10
Alternative Catalog Number: LS-C661892-10
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527 aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Conjugation: Unconjugated
Alternative Names: GAA, Acid maltase, Aglucosidase alfa, Glucosidase, alpha, Lysosomal alpha-glucosidase, Glucosidase, alpha acid, LYAG
Clonality: Polyclonal
NCBI: 2548
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Application Notes: IHC, WB
Western blot analysis of GAA expr