Polyclonal Rabbit anti-Human PVRL4 / Nectin 4 Antibody (WB) LS-C662971

Catalog Number: LS-C662971-100
Article Name: Polyclonal Rabbit anti-Human PVRL4 / Nectin 4 Antibody (WB) LS-C662971
Biozol Catalog Number: LS-C662971-100
Supplier Catalog Number: LS-C662971-100
Alternative Catalog Number: LS-C662971-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human Nectin-4/PVRL4 (53-94 aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
Conjugation: Unconjugated
Alternative Names: PVRL4, EDSS1, Nectin 4, Ig superfamily receptor LNIR, Poliovirus receptor-like 4, LNIR, Nectin-4, Poliovirus receptor-related 4
Nectin 4 antibody LS-C662971 is an unconjugated rabbit polyclonal antibody to human Nectin 4 (PVRL4). Validated for WB.
Clonality: Polyclonal
NCBI: 81607
Buffer: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Purity: Immunogen affinity purified
Form: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Application Dilute: WB
Application Notes: WB