Polyclonal Rabbit anti-Human LHX9 Antibody (WB) LS-C747799

Product Overview

• Article Name: Polyclonal Rabbit anti-Human LHX9 Antibody (WB) LS-C747799
• Biozol Catalog Number: LS-C747799-100
• Supplier Catalog Number: LS-C747799-100
• Alternative Catalog Number: LS-C747799-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2). MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL
• Conjugation: Unconjugated
• Alternative Names: LHX9, LIM homeobox 9, LIM homeobox protein 9, LIM/homeobox protein Lhx9

Product Description

LHX9 antibody LS-C747799 is an unconjugated rabbit polyclonal antibody to LHX9 from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 56956
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 36kDa/37kDa/42kDa/43kDa, while the observed MW by Western blot was 54kDa.