Polyclonal Rabbit anti-Human MDC1 Antibody (WB) LS-C747801

Product Overview

• Article Name: Polyclonal Rabbit anti-Human MDC1 Antibody (WB) LS-C747801
• Biozol Catalog Number: LS-C747801-100
• Supplier Catalog Number: LS-C747801-100
• Alternative Catalog Number: LS-C747801-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MDC1 (NP_055456.2). MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQI
• Conjugation: Unconjugated
• Alternative Names: MDC1, Em:AB023051.5, NFBD1, KIAA0170

Product Description

MDC1 antibody LS-C747801 is an unconjugated rabbit polyclonal antibody to MDC1 from human. It is reactive with human and mouse. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 9656
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 116kDa/195kDa/197kDa/226kDa, while the observed MW by Western blot was 200kDa.