Polyclonal Rabbit anti-Human TAZ Antibody (WB) LS-C747803

Catalog Number: LS-C747803-20
Article Name: Polyclonal Rabbit anti-Human TAZ Antibody (WB) LS-C747803
Biozol Catalog Number: LS-C747803-20
Supplier Catalog Number: LS-C747803-20
Alternative Catalog Number: LS-C747803-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 174-248 of human TAZ (NP_851830.1). NDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Conjugation: Unconjugated
Alternative Names: TAZ, BTHS, EFE, Endocardial fibroelastosis 2, EFE2, LVNCX, Protein G4.5, Tafazzin, CMD3A, G4.5, TAZ1, XAP-2
TAZ antibody LS-C747803 is an unconjugated rabbit polyclonal antibody to TAZ from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 6901
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:1000 - 1:2000)
Application Notes: The predicted MW is 25kDa/27kDa/28kDa/29kDa/30kDa/31kDa/33kDa, while the observed MW by Western blot was 50kDa.