Polyclonal Rabbit anti-Human SLC25A19 Antibody (WB) LS-C747808

Product Overview

• Article Name: Polyclonal Rabbit anti-Human SLC25A19 Antibody (WB) LS-C747808
• Biozol Catalog Number: LS-C747808-100
• Supplier Catalog Number: LS-C747808-100
• Alternative Catalog Number: LS-C747808-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SLC25A19 (NP_068380.3). MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK
• Conjugation: Unconjugated
• Alternative Names: SLC25A19, DNC, THMD4, MCPHA, TPC, Microcephaly, Amish, THMD3

Product Description

SLC25A19 antibody LS-C747808 is an unconjugated rabbit polyclonal antibody to SLC25A19 from human. It is reactive with human and mouse. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 60386
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:1000 - 1:2000)
• Application Notes: The predicted MW is 29kDa/35kDa.