Polyclonal Rabbit anti-Human CNTN3 / Contactin 3 Antibody (WB) LS-C749739

Product Overview

• Article Name: Polyclonal Rabbit anti-Human CNTN3 / Contactin 3 Antibody (WB) LS-C749739
• Biozol Catalog Number: LS-C749739-20
• Supplier Catalog Number: LS-C749739-20
• Alternative Catalog Number: LS-C749739-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human CNTN3 (NP_065923.1). ELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDIDMSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIV
• Conjugation: Unconjugated
• Alternative Names: CNTN3, BIG-1, KIAA1496, PANG, PCS, Contactin-3

Product Description

Contactin 3 antibody LS-C749739 is an unconjugated rabbit polyclonal antibody to Contactin 3 (CNTN3) from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 5067
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 112kDa, while the observed MW by Western blot was 113kDa.