Polyclonal Rabbit anti-Human SLC4A8 / NBC Antibody (WB) LS-C749806

Catalog Number: LS-C749806-20
Article Name: Polyclonal Rabbit anti-Human SLC4A8 / NBC Antibody (WB) LS-C749806
Biozol Catalog Number: LS-C749806-20
Supplier Catalog Number: LS-C749806-20
Alternative Catalog Number: LS-C749806-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1). MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
Conjugation: Unconjugated
Alternative Names: SLC4A8, K-NBC3, KIAA0739, KNBC3, NBC3, NDCBE, NDCBE1, Nbc-3, NBC
NBC antibody LS-C749806 is an unconjugated rabbit polyclonal antibody to NBC (SLC4A8) from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 9498
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 71kDa/77kDa/83kDa/111kDa/117kDa/120kDa/122kDa, while the observed MW by Western blot was 123kDa.