Polyclonal Rabbit anti-Human SLC7A8 / LAT2 Antibody (WB) LS-C749842

Catalog Number: LS-C749842-20
Article Name: Polyclonal Rabbit anti-Human SLC7A8 / LAT2 Antibody (WB) LS-C749842
Biozol Catalog Number: LS-C749842-20
Supplier Catalog Number: LS-C749842-20
Alternative Catalog Number: LS-C749842-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A8 (NP_036376.2). LFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNF
Conjugation: Unconjugated
Alternative Names: SLC7A8, HLAT2, LPI-PC1, Integral membrane protein E16H
LAT2 antibody LS-C749842 is an unconjugated rabbit polyclonal antibody to human LAT2 (SLC7A8). Validated for WB.
Clonality: Polyclonal
NCBI: 23428
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 34kDa/37kDa/48kDa/58kDa, while the observed MW by Western blot was 58kDa.