Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750136

Catalog Number: LS-C750136-100
Article Name: Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750136
Biozol Catalog Number: LS-C750136-100
Supplier Catalog Number: LS-C750136-100
Alternative Catalog Number: LS-C750136-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2). MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDT
Conjugation: Unconjugated
Alternative Names: RNF125, RING finger protein 125, TRAC-1, TRAC1
TRAC-1 antibody LS-C750136 is an unconjugated rabbit polyclonal antibody to human TRAC-1 (RNF125). Validated for WB.
Clonality: Polyclonal
NCBI: 54941
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 26kDa, while the observed MW by Western blot was 28kDa.