Polyclonal Rabbit anti-Human PSENEN / PEN-2 Antibody (WB) LS-C750142

Product Overview

• Article Name: Polyclonal Rabbit anti-Human PSENEN / PEN-2 Antibody (WB) LS-C750142
• Biozol Catalog Number: LS-C750142-100
• Supplier Catalog Number: LS-C750142-100
• Alternative Catalog Number: LS-C750142-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-Terminus of human PSENEN (NP_758844.1). LGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
• Conjugation: Unconjugated
• Alternative Names: PSENEN, Gamma-secretase subunit PEN-2, MSTP064, Presenilin enhancer protein 2, MDS033, PEN-2, PEN2

Product Description

PEN-2 antibody LS-C750142 is an unconjugated rabbit polyclonal antibody to PEN-2 (PSENEN) from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 55851
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 12kDa, while the observed MW by Western blot was 16kDa.