Polyclonal Rabbit anti-Hepatitis B Virus HBV / Hepatitis B Virus Antibody (IHC, WB) LS-C782761

Catalog Number: LS-C782761-100
Article Name: Polyclonal Rabbit anti-Hepatitis B Virus HBV / Hepatitis B Virus Antibody (IHC, WB) LS-C782761
Biozol Catalog Number: LS-C782761-100
Supplier Catalog Number: LS-C782761-100
Alternative Catalog Number: LS-C782761-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Virus
Immunogen: Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.
Conjugation: Unconjugated
Hepatitis B Virus antibody LS-C782761 is an unconjugated rabbit polyclonal antibody to hepatitis b virus Hepatitis B Virus (HBV). Validated for IHC and WB.
Clonality: Polyclonal
Buffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Purity: Antigen Affinity purification
Form: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Dilute: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
Application Notes: Optimal dilution of the Hepatitis B Virus antibody should be determined by the researcher.