Polyclonal Rabbit anti-Mouse PDGF-BB Antibody (WB) LS-C782773
Catalog Number:
LS-C782773-100
| Article Name: |
Polyclonal Rabbit anti-Mouse PDGF-BB Antibody (WB) LS-C782773 |
| Biozol Catalog Number: |
LS-C782773-100 |
| Supplier Catalog Number: |
LS-C782773-100 |
| Alternative Catalog Number: |
LS-C782773-100 |
| Manufacturer: |
LifeSpan Biosciences |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
Amino acids 89-129 (AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR) from the human protein were used as the immunogen for the PDGF beta antibody. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
PDGFB, PDGF-BB, PDGF-b, SSV, PDGF subunit B, PDGF-2, PDGF2, Proto-oncogene c-Sis, SIS, C-sis, PDGF, B chain |
| PDGF-BB antibody LS-C782773 is an unconjugated rabbit polyclonal antibody to PDGF-BB from mouse. It is reactive with mouse and rat. Validated for WB. |
| Clonality: |
Polyclonal |
| NCBI: |
5155 |
| Buffer: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Purity: |
Antigen Affinity purification |
| Form: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Application Dilute: |
WB (0.5 - 1 µg/ml) |
| Application Notes: |
Optimal dilution of the PDGF beta antibody should be determined by the researcher. |
