Polyclonal Rabbit anti-Human IFNAR1 / IFNAR Antibody (WB) LS-C782783

Catalog Number: LS-C782783-100
Article Name: Polyclonal Rabbit anti-Human IFNAR1 / IFNAR Antibody (WB) LS-C782783
Biozol Catalog Number: LS-C782783-100
Supplier Catalog Number: LS-C782783-100
Alternative Catalog Number: LS-C782783-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Amino acids 263-306 (HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) from the human protein were used as the immunogen for the IFNAR1 antibody.
Conjugation: Unconjugated
Alternative Names: IFNAR1, Alpha-type antiviral protein, Beta-type antiviral protein, CRF2-1, IFN-alpha/beta receptor 1, IFN-alpha-REC, IFN-R-1, IFNAR, IFNBR, IFRC, Interferon-beta receptor 1, Interferon-alpha receptor, Type I interferon receptor 1
IFNAR antibody LS-C782783 is an unconjugated rabbit polyclonal antibody to IFNAR (IFNAR1) from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 3454
Buffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Purity: Antigen Affinity purification
Form: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Dilute: WB (0.5 - 1 µg/ml)
Application Notes: Optimal dilution of the IFNAR1 antibody should be determined by the researcher.