Anti-EIF4E pAb

Product Overview

• Article Name: Anti-EIF4E pAb
• Biozol Catalog Number: MBL-RN001P
• Supplier Catalog Number: RN001P
• Alternative Catalog Number: MBL-RN001P
• Manufacturer: MBL
• Host: Rb
• Category: Antikörper
• Application: IP, IP, WB, ICC
• Species Reactivity: Hu, Ms, Rt, Hmst
• Immunogen: KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.)
• Conjugation: Unconjugated

Product Description

Anti-EIF4E pAb, Unconjugated, Rabbit, Polyclonal

Product Properties

• Clonality: Polyclonal
• Concentration: 1 mg/mL
• NCBI: 1977
• Buffer: 200 µl volume of PBS containing 50% glycerol, pH 7.2. No preservative is contained.
• Source: This antibody was purified from rabbit serum by affinity column chromatography. The rabbit was immunized with KLH conjugated synthetic peptide, MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH corresponding to 1-37 aa.
• Target: EIF4E

Application Notes

• Application Dilute: WB: 1:1,000 for chemiluminescence detection system. IP: 5 µg/250 µL of cell extract from 2.5 x 106 cells. RIP: 15 µg/500 µL of cell extract from 4.5 x 106 cells