200 µL volume of PBS containing 50% glycerol, pH 7.2
Source:
This antibody was purified from rabbit serum by affinity column chromatography. The rabbit was immunized with KLH conjugated synthetic peptide, MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH corresponding to 1-37 aa.
Target:
EIF4E
Application Dilute:
WB: 1:1,000 for chemiluminescence detection system. IP: 5 µg/250 µL of cell extract from 2.5 x 106 cells. RIP: 15 µg/500 µL of cell extract from 4.5 x 106 cells
* VAT and and shipping costs not included. Errors and price changes excepted