VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage

Product Overview

• Article Name: VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage
• Biozol Catalog Number: MCE-HY-P3431
• Supplier Catalog Number: HY-P3431
• Alternative Catalog Number: MCE-HY-P3431-1UNIT
• Manufacturer: MedchemExpress
• Category: Proteine/Peptide

Product Description

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of alpha2delta-1, termed as alpha2delta-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the alpha2delta-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain[1].

Product Properties

• Molecular Weight: 3490.06
• CAS Number: [2279952-25-7]
• Formula: C171H250N40O39
• Target: iGluR

Application Notes

• Application Notes: MCE Product type: Peptides