RAGE Antibody, Rabbit, Polyclonal

Catalog Number: NSJ-R32232
Article Name: RAGE Antibody, Rabbit, Polyclonal
Biozol Catalog Number: NSJ-R32232
Supplier Catalog Number: R32232
Alternative Catalog Number: NSJ-R32232
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Amino acids IQDEGIFRCQAMNRNGKETKSNYRVRVYQI of human RAGE were used as the immunogen for the RAGE antibody.
The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimers disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.
Clonality: Polyclonal
UniProt: Q15109
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity: Antigen affinity
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Dilute: Western blot: 0.1-0.5ug/ml,IHC (FFPE): 0.5-1ug/ml
Application Notes: Optimal dilution of the RAGE antibody should be determined by the researcher.