STXBP2 Antibody / UNC18-2, Rabbit, Polyclonal

Catalog Number: NSJ-R32239
Article Name: STXBP2 Antibody / UNC18-2, Rabbit, Polyclonal
Biozol Catalog Number: NSJ-R32239
Supplier Catalog Number: R32239
Alternative Catalog Number: NSJ-R32239
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: FACS, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.
Syntaxin-binding protein 2, also known as UNC18B and UNC18-2, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Clonality: Polyclonal
UniProt: Q15833
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity: Antigen affinity
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Dilute: Western blot: 0.1-0.5ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Notes: Optimal dilution of the STXBP2 antibody should be determined by the researcher.