PDK4 Antibody, Rabbit, Polyclonal

Catalog Number: NSJ-R32250
Article Name: PDK4 Antibody, Rabbit, Polyclonal
Biozol Catalog Number: NSJ-R32250
Supplier Catalog Number: R32250
Alternative Catalog Number: NSJ-R32250
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Amino acids WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN of human PDK4 were used as the immunogen for the PDK4 antibody.
Pyruvate dehydrogenase lipoamide kinase isozyme 4, mitochondrial is an enzyme that in humans is encoded by the PDK4 gene. This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. In addition, PDK4 is increased in hibernation and helps to decrease metabolism and conserve glucose by decreasing its conversion to acetyl-CoA, which enters the citric acid cycle and is converted to ATP.
Clonality: Polyclonal
UniProt: Q16654
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity: Antigen affinity
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Dilute: Western blot: 0.5-1ug/ml
Application Notes: Optimal dilution of the PDK4 antibody should be determined by the researcher.