beta-Amyloid (11-40)

Product Overview

• Article Name: beta-Amyloid (11-40)
• Biozol Catalog Number: PEL-EP10013_5
• Supplier Catalog Number: EP10013_5
• Alternative Catalog Number: PEL-EP10013_5
• Manufacturer: peptides and elephants
• Category: Proteine/Peptide
• Application: ELISpot, FACS, FC, FluoroSpot, IHC, WB
• Species Reactivity: Human

Product Description

Post-mortem Alzheimers diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading t

Product Properties

• Purity: 95%
• Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV