LL - 37

Catalog Number: PEL-EP11651_1
Article Name: LL - 37
Biozol Catalog Number: PEL-EP11651_1
Supplier Catalog Number: EP11651_1
Alternative Catalog Number: PEL-EP11651_1
Manufacturer: peptides and elephants
Category: Proteine/Peptide
Application: ELISpot, FACS, FC, FluoroSpot, IHC, WB
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,i belongsi to the cathelicidin family of peptides, and this peptide corresponds to the sequence
Purity: 95%
Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES