Eotaxin-2, Human Recombinant (CCL24)
Catalog Number:
RAY-228-10398-3
- Images (0)
| Article Name: | Eotaxin-2, Human Recombinant (CCL24) |
| Biozol Catalog Number: | RAY-228-10398-3 |
| Supplier Catalog Number: | 228-10398-3 |
| Alternative Catalog Number: | RAY-228-10398-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24. |
| NCBI: | 6369 |
| Expression System: | E. coli |
| Purity: | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA. |
| Formula: | The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. |
Product Guarantee and Expert Support
