Fibroblast Growth Factor-23, Human Recombinant, His Tag
Catalog Number:
RAY-228-10462-2
- Images (0)
| Article Name: | Fibroblast Growth Factor-23, Human Recombinant, His Tag |
| Biozol Catalog Number: | RAY-228-10462-2 |
| Supplier Catalog Number: | 228-10462-2 |
| Alternative Catalog Number: | RAY-228-10462-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23. |
| NCBI: | 8074 |
| Expression System: | E. coli |
| Purity: | Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered white lyophilized powder. |
| Sequence: | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHH |
| Formula: | The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution. |
Product Guarantee and Expert Support
