Interleukin-1 beta, Rat Recombinant
Catalog Number:
RAY-228-10849-2
- Images (0)
| Article Name: | Interleukin-1 beta, Rat Recombinant |
| Biozol Catalog Number: | RAY-228-10849-2 |
| Supplier Catalog Number: | 228-10849-2 |
| Alternative Catalog Number: | RAY-228-10849-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Rat |
| Alternative Names: | Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. |
| Expression System: | E. coli |
| Purity: | Greater than 97.0% as determined by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS. |
| Formula: | The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4. |
Product Guarantee and Expert Support
