Retinoblastoma Associated Protein, Human Recombinant
Catalog Number:
RAY-228-11363-2
- Images (0)
| Article Name: | Retinoblastoma Associated Protein, Human Recombinant |
| Biozol Catalog Number: | RAY-228-11363-2 |
| Supplier Catalog Number: | 228-11363-2 |
| Alternative Catalog Number: | RAY-228-11363-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINOBLASTOMA-RELATED,PP110, Retinoblastoma-associated protein. |
| NCBI: | 5925 |
| Expression System: | E. coli |
| Purity: | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH. |
| Formula: | The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4. |
Product Guarantee and Expert Support
