Thymus & Activation Regulated Chemokine, Human Recombinant (CCL17)
Catalog Number:
RAY-228-11481-2
- Images (0)
| Article Name: | Thymus & Activation Regulated Chemokine, Human Recombinant (CCL17) |
| Biozol Catalog Number: | RAY-228-11481-2 |
| Supplier Catalog Number: | 228-11481-2 |
| Alternative Catalog Number: | RAY-228-11481-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273. |
| NCBI: | 6361 |
| Expression System: | E. coli |
| Purity: | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS. |
| Formula: | The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4. |
Product Guarantee and Expert Support
