Trefoil Factor-1, Human Recombinant
Catalog Number:
RAY-228-11489-3
- Images (0)
| Article Name: | Trefoil Factor-1, Human Recombinant |
| Biozol Catalog Number: | RAY-228-11489-3 |
| Supplier Catalog Number: | 228-11489-3 |
| Alternative Catalog Number: | RAY-228-11489-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein. |
| NCBI: | 7031 |
| Expression System: | E. coli |
| Purity: | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF. |
| Formula: | The protein was lyophilized after dialysis against 1xPBS pH-7.4. |
Product Guarantee and Expert Support
