Vascular Endothelial Growth Factor Related Protein, Rat Recombinant

Product Overview

• Article Name: Vascular Endothelial Growth Factor Related Protein, Rat Recombinant
• Biozol Catalog Number: RAY-228-11620-3
• Supplier Catalog Number: 228-11620-3
• Alternative Catalog Number: RAY-228-11620-3
• Manufacturer: RayBiotech
• Category: Proteine/Peptide
• Species Reactivity: Rat
• Alternative Names: VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.

Product Properties

• NCBI: 83785
• Expression System: Sf9 Insect Cells
• Purity: Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH.
• Formula: Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.