Human Vascular Endothelial Growth Inhibitor Recombinant

Catalog Number: RAY-228-11632-2
Article Name: Human Vascular Endothelial Growth Inhibitor Recombinant
Biozol Catalog Number: RAY-228-11632-2
Supplier Catalog Number: 228-11632-2
Alternative Catalog Number: RAY-228-11632-2
Manufacturer: RayBiotech
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935.
NCBI: 9966
Expression System: E. coli
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.
Formula: The TNFSF15 was lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.