Human Vascular Endothelial Growth Inhibitor Recombinant
Catalog Number:
RAY-228-11632-2
| Article Name: |
Human Vascular Endothelial Growth Inhibitor Recombinant |
| Biozol Catalog Number: |
RAY-228-11632-2 |
| Supplier Catalog Number: |
228-11632-2 |
| Alternative Catalog Number: |
RAY-228-11632-2 |
| Manufacturer: |
RayBiotech |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Human |
| Alternative Names: |
Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935. |
| NCBI: |
9966 |
| Expression System: |
E. coli |
| Purity: |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: |
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL. |
| Formula: |
The TNFSF15 was lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20. |