West Nile Virus Pre-M Recombinant
Catalog Number:
RAY-228-11649-3
| Article Name: |
West Nile Virus Pre-M Recombinant |
| Biozol Catalog Number: |
RAY-228-11649-3 |
| Supplier Catalog Number: |
228-11649-3 |
| Alternative Catalog Number: |
RAY-228-11649-3 |
| Manufacturer: |
RayBiotech |
| Category: |
Proteine/Peptide |
| Purity: |
Purified by proprietary chromatographic technique. |
| Sequence: |
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE. |
| Formula: |
20mM phosphate buffer pH 7.5. |
| Application Dilute: |
Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems. |
