Helicobacter Pylori Outer Membrane Protein Recombinant
Catalog Number:
RAY-228-11712-3
- Images (0)
| Article Name: | Helicobacter Pylori Outer Membrane Protein Recombinant |
| Biozol Catalog Number: | RAY-228-11712-3 |
| Supplier Catalog Number: | 228-11712-3 |
| Alternative Catalog Number: | RAY-228-11712-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Bacteria |
| Expression System: | E. coli |
| Purity: | Purified by proprietary chromatographic technique. |
| Form: | Sterile filtered liquid formulation. |
| Sequence: | MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL. |
| Formula: | The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. |
Product Guarantee and Expert Support
