LR3 Insulin Like Growth Factor-1, Human Recombinant
Catalog Number:
RAY-228-11894-2
- Images (0)
| Article Name: | LR3 Insulin Like Growth Factor-1, Human Recombinant |
| Biozol Catalog Number: | RAY-228-11894-2 |
| Supplier Catalog Number: | 228-11894-2 |
| Alternative Catalog Number: | RAY-228-11894-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1. |
| Expression System: | E. coli |
| Purity: | Greater than 95.0% as determined by SDS-PAGE and HPLC. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA. |
| Formula: | Lyophilized from a 0.2 um filtered concentrated solution in 1xPBS. |
Product Guarantee and Expert Support
