Epstein Barr Virus Induced 3, Human Recombinant
Catalog Number:
RAY-228-12040-2
- Images (0)
| Article Name: | Epstein Barr Virus Induced 3, Human Recombinant |
| Biozol Catalog Number: | RAY-228-12040-2 |
| Supplier Catalog Number: | 228-12040-2 |
| Alternative Catalog Number: | RAY-228-12040-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B. |
| NCBI: | 10148 |
| Expression System: | E. coli |
| Purity: | Greater than 90% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK. |
| Formula: | EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol. |
Product Guarantee and Expert Support
