Matrix Metalloproteinase-9 Rabbit Recombinant
Catalog Number:
RAY-228-12273-3
- Images (0)
| Article Name: | Matrix Metalloproteinase-9 Rabbit Recombinant |
| Biozol Catalog Number: | RAY-228-12273-3 |
| Supplier Catalog Number: | 228-12273-3 |
| Alternative Catalog Number: | RAY-228-12273-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Rabbit |
| Alternative Names: | Matrix metalloproteinase-9, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B. |
| NCBI: | 100008993 |
| Expression System: | Baculovirus, Insect Cells |
| Purity: | Greater than 85.0% as determined by SDS-PAGE. |
| Form: | Sterile Filtered clear solution. |
| Sequence: | APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSE |
| Formula: | The MMP-9 solution (0.3mg/ml) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5. |
Product Guarantee and Expert Support
