Anti-BNP-32 Antibody, Polyclonal

Product Overview

• Article Name: Anti-BNP-32 Antibody, Polyclonal
• Biozol Catalog Number: RAY-RB-13-0001-100
• Supplier Catalog Number: RB-13-0001-100
• Alternative Catalog Number: RAY-RB-13-0001-100
• Manufacturer: RayBiotech
• Category: Antikörper
• Species Reactivity: Human
• Immunogen: The imunogen was synthetic peptide. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum followed by Protein A/G affinity chromatography.

Product Description

Rabbit Anti-Human BNP-32 Antibody

Product Properties

• Clonality: Polyclonal
• NCBI: 4879
• UniProt: P16860
• Sequence: SPKMVQGSGCFGRKMDRSSSSGLGCKVLRRH

Application Notes

• Application Notes: ELISA (recommended work dilution= 1:2000)