Anti-BNP-32 Antibody, Polyclonal

Catalog Number: RAY-RB-13-0001-200
Article Name: Anti-BNP-32 Antibody, Polyclonal
Biozol Catalog Number: RAY-RB-13-0001-200
Supplier Catalog Number: RB-13-0001-200
Alternative Catalog Number: RAY-RB-13-0001-200
Manufacturer: RayBiotech
Category: Antikörper
Species Reactivity: Human
Immunogen: The imunogen was synthetic peptide. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum followed by Protein A/G affinity chromatography.
Rabbit Anti-Human BNP-32 Antibody
Clonality: Polyclonal
NCBI: 4879
UniProt: P16860
Sequence: SPKMVQGSGCFGRKMDRSSSSGLGCKVLRRH
Application Notes: ELISA (recommended work dilution= 1:2000)