Anti-NPF Antibody, Polyclonal

Product Overview

• Article Name: Anti-NPF Antibody, Polyclonal
• Biozol Catalog Number: RAY-RB-19-0001-200
• Supplier Catalog Number: RB-19-0001-200
• Alternative Catalog Number: RAY-RB-19-0001-200
• Manufacturer: RayBiotech
• Category: Antikörper
• Species Reactivity: Human
• Immunogen: Immunogen is a synthetic peptide derived from Drosophila Neuropeptide F. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography.

Product Description

Rabbit Anti-NPF Antibody

Product Properties

• Clonality: Polyclonal
• UniProt: NP_536741
• Sequence: CSNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF

Application Notes

• Application Notes: ELISA (recommended work dilution= 1: 1,000-5,000)