RM IL-19

Product Overview

• Article Name: RM IL-19
• Biozol Catalog Number: SHD-200-75-100UG
• Supplier Catalog Number: 200-75-100UG
• Alternative Catalog Number: SHD-200-75-100UG
• Manufacturer: Fujifilm Irvine Scientific
• Category: Proteine/Peptide
• Application: Bioassay, SDS-PAGE
• Species Reactivity: Mouse

Product Description

Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor

Product Properties

• Molecular Weight: 17.7
• UniProt: Q8CJ70
• Buffer: 10 mM Sodium Phosphate, 50 mM Sodium Chloride, pH 7.5
• Source: E.coli
• Purity: 95
• Form: Lyophilized from a 0.2 µm filtered solution
• Sequence: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Application Notes

• Application Notes: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.