RM IL-19 (AF)

Catalog Number: SHD-200-75AF-500UG
Article Name: RM IL-19 (AF)
Biozol Catalog Number: SHD-200-75AF-500UG
Supplier Catalog Number: 200-75AF-500UG
Alternative Catalog Number: SHD-200-75AF-500UG
Manufacturer: Fujifilm Irvine Scientific
Category: Proteine/Peptide
Application: Bioassay, SDS-PAGE
Species Reactivity: Mouse
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor
Molecular Weight: 17.7
UniProt: Q8CJ70
Buffer: 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Source: E.coli
Purity: 95
Form: Lyophilized from a 0.2 µm filtered solution
Sequence: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Application Notes: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.