Anti-HGFR / c-Met Reference Antibody (emibetuzumab), IgG1, Monoclonal

Product Overview

• Article Name: Anti-HGFR / c-Met Reference Antibody (emibetuzumab), IgG1, Monoclonal
• Biozol Catalog Number: SYB-CHA249
• Supplier Catalog Number: CHA249
• Alternative Catalog Number: SYB-CHA249-100UG,SYB-CHA249-1MG
• Manufacturer: Sanyou Bio
• Category: Antikörper
• Application: ELISA, FA, FACS, Kinetics
• Species Reactivity: Human

Product Description

Anti-HGFR / c-Met Reference Antibody (emibetuzumab)(CHA249) is expressed from CHO. The heavy chain type is huIgG4SP, and the light chain type is hukappa. It has a predicted MW of 145.5 kDa.

Product Properties

• Clonality: Monoclonal
• Concentration: 1mg/ml
• Isotype: IgG1
• UniProt: P08581
• Buffer: 25mM histidine, 8% sucrose, 0.01% Tween80 pH6.2
• Purity: >95%
• Form: Lyophilize
• Sequence: Antibody sequence HC : QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGRVNPNRRGTTYNQKFEGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARANWLDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEAAG
• Target: HGFR / c-Met