GLP-1 (7-36), amide, chicken, common turkey Preis auf Anfrage
Catalog Number:
TGM-TP3159
| Article Name: |
GLP-1 (7-36), amide, chicken, common turkey Preis auf Anfrage |
| Biozol Catalog Number: |
TGM-TP3159 |
| Supplier Catalog Number: |
TP3159 |
| Alternative Catalog Number: |
TGM-TP3159-1MG,TGM-TP3159-5MG |
| Manufacturer: |
TargetMol |
| Category: |
Biochemikalien |
| GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2. |
| Molecular Weight: |
3327.61 |
| Formula: |
C149H224N40O47 |
![]()
|
TP3159 |
